Basic Information | |
---|---|
Taxon OID | 3300029566 Open in IMG/M |
Scaffold ID | Ga0244934_104578 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Shanghai, China - P040V6 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5259 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Hungatella → Hungatella hathewayi | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074899 | Metagenome / Metatranscriptome | 119 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0244934_1045787 | F074899 | N/A | MSGRKQWNKQAATSSFLGKKTPQSLIQQGLEGSTVVGKDEVTSSNLVSSSRTTPEIFG |
⦗Top⦘ |