Scaffold Ga0244915_100157

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0244915_100157

Scaffold Ga0244915_100157

Overview

Basic Information
Taxon OID	3300029559 Open in IMG/M
Scaffold ID	Ga0244915_100157 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Shanghai, China - P031V1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	86563
Total Scaffold Genes	117 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	23 (19.66%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location Name	China: Shanghai
Coordinates	Lat. (^o)	31.2112312	Long. (^o)	121.4647709	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089054	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244915_10015764	F089054	N/A	MLTSGKFLVSFEVPGPLPGTTEGFCEEMNVVYRTEELNTYLRYPKQQINPWHKHSTYIRLKLRDILQIPLTGITIIDIIPLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.