Basic Information | |
---|---|
Taxon OID | 3300029542 Open in IMG/M |
Scaffold ID | Ga0244933_100799 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Shanghai, China - P040V1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 29615 |
Total Scaffold Genes | 32 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 31 (96.88%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026489 | Metagenome | 197 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0244933_10079910 | F026489 | GGAGG | LVAKENQKTTSDFDALEPRKRGCSPLLTPKKWATPEKTEDSRLFGVKIF |
⦗Top⦘ |