Scaffold Ga0244010_1037341

Overview

Basic Information

• Taxon OID: 3300029493
• Scaffold ID: Ga0244010_1037341
• Source Dataset Name: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 097_5_2_stool_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 876
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location

• Location Name: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0244010_10373411	F029444	N/A	MEVSGQLTGFELEDLKFWTVSNLQRPFREDFSLEKSGIIAEKESQIFGRRFVGFDS