Scaffold Ga0244102_104798

Overview

Basic Information

• Taxon OID: 3300029483
• Scaffold ID: Ga0244102_104798
• Source Dataset Name: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001857-108
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5427
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Source Dataset Sampling Location

• Location Name: China: Shanghai
• Coordinates
  • Lat. (^o): 31.2123446
  • Long. (^o): 121.4684853

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078822	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244102_1047988	F078822	N/A	SSTFFDIFLNFPNAFLKAFYPHAVRFPAAFLLVHRFYLAFEELLSCATAYL