| Basic Information | |
|---|---|
| Taxon OID | 3300029478 Open in IMG/M |
| Scaffold ID | Ga0244154_102540 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001912-102 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8333 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076190 | Metagenome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0244154_10254012 | F076190 | N/A | NGRSSWARTAGGSITISVKNVFTAASRVSGRVWSLVRITVPNDLKSVRIRGRKTQNNSLYSYFQREPL |
| ⦗Top⦘ |