Scaffold Ga0244104_100541

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0244104_100541

Scaffold Ga0244104_100541

Overview

Basic Information
Taxon OID	3300029467 Open in IMG/M
Scaffold ID	Ga0244104_100541 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001859-113
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	47545
Total Scaffold Genes	67 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	22 (32.84%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Source Dataset Sampling Location
Location Name	China: Shanghai
Coordinates	Lat. (^o)	31.2123446	Long. (^o)	121.4684853	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244104_10054166	F055775	N/A	MAQIAQQDNLVIEVTTTAAALDGDTKKKLIECIEGGTIADVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSGKVEAIALN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.