| Basic Information | |
|---|---|
| Taxon OID | 3300029449 Open in IMG/M |
| Scaffold ID | Ga0243128_1005071 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellow Sea, Weihai, China - HGD.1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shandong University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5298 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Weihai | |||||||
| Coordinates | Lat. (o) | 37.31 | Long. (o) | 122.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103319 | Metagenome / Metatranscriptome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0243128_10050712 | F103319 | GGAGG | MADQYNSIGHHPKSTYMTSEGHALHNISGLDLIIDIAGVYFPLRSINYAANHNVTDEHGTGTHDPVALTNQEHTYTGTFTYASFLVTGENVLTQKDVLALTQLLQDQADEGVSKYFDIYIIEVQGKRTPGTGTTFEEQVEAALQNESMVGYIEALVDCKVTKVNRDIPEKNTVVSSREFKYSYKLPR |
| ⦗Top⦘ |