| Basic Information | |
|---|---|
| Taxon OID | 3300029441 Open in IMG/M |
| Scaffold ID | Ga0243753_1001744 Open in IMG/M |
| Source Dataset Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 029_10_30_stool_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 28400 |
| Total Scaffold Genes | 30 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 29 (96.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0243753_100174410 | F026489 | GGGGG | LVAKENQKTTSDFDALEPRKRGCSPLLTPKKWAAPKKTEDSRLFGVKVF |
| ⦗Top⦘ |