| Basic Information | |
|---|---|
| Taxon OID | 3300029429 Open in IMG/M |
| Scaffold ID | Ga0239577_1003392 Open in IMG/M |
| Source Dataset Name | Oil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Lawrence Berkeley National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3460 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 24.74 | Long. (o) | -88.37 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101886 | Metagenome / Metatranscriptome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0239577_10033922 | F101886 | N/A | MLKKIAIIAFCLFNVALFIQIGIDVAAVTPEQAMLEGMTQRIYASISTLDYIMATLWGVILYTILTAKKEYFLRVSWLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVAVQIGFLFWAKIRINTANFALSN |
| ⦗Top⦘ |