| Basic Information | |
|---|---|
| Taxon OID | 3300029370 Open in IMG/M |
| Scaffold ID | Ga0243957_127194 Open in IMG/M |
| Source Dataset Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_27_stool_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 559 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070093 | Metagenome | 123 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0243957_1271941 | F070093 | N/A | ESLFLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNLI |
| ⦗Top⦘ |