Scaffold Ga0243320_1010080

Overview

Basic Information

• Taxon OID: 3300029337
• Scaffold ID: Ga0243320_1010080
• Source Dataset Name: Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-22_Run5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Zhejiang University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2515
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Source Dataset Sampling Location

• Location Name: China: Hangzhou
• Coordinates
  • Lat. (^o): 30.0
  • Long. (^o): 120.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0243320_10100803	F047125	AGGA	MDVVLLLIVLGVMLSGFWAADALDHIRREILRQEGKRRGWWS