NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243320_1001454

Scaffold Ga0243320_1001454


Overview

Basic Information
Taxon OID3300029337 Open in IMG/M
Scaffold IDGa0243320_1001454 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-22_Run5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterZhejiang University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18891
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (84.21%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Source Dataset Sampling Location
Location NameChina: Hangzhou
CoordinatesLat. (o)30.0Long. (o)120.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052660Metagenome142N

Sequences

Protein IDFamilyRBSSequence
Ga0243320_100145417F052660AGGAMCILRILPENTPEKIGQERAGTEWTVVKSKIRLCIRNRSYGRFLHGILMGIVLPIPSHRAKSHDFACWWPVAAGHSRSADALPGKSNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.