Scaffold Ga0243509_100038

Overview

Basic Information

• Taxon OID: 3300029327
• Scaffold ID: Ga0243509_100038
• Source Dataset Name: Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Tokyo University of Pharmacy and Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 185321
• Total Scaffold Genes: 194
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 75 (38.66%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm → Electrode-Associated Soil And Biofilms Microbial Communities From Mfcs In Japan

Source Dataset Sampling Location

• Location Name: Japan: Tokyo
• Coordinates
  • Lat. (^o): 35.638
  • Long. (^o): 139.3817

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056624	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0243509_100038172	F056624	N/A	MTVSHEEFDNLANHCQTCRDETRDKLAAFDRRLLALEIIVRGEDGRNGIKSQINTLCLRFDAFEKKAIRWIAVGTALPGIVVGVLGVLKFIGKL