Basic Information | |
---|---|
Taxon OID | 3300029326 Open in IMG/M |
Scaffold ID | Ga0243238_103271 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-62_Run5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Zhejiang University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4343 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Hangzhou | |||||||
Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026489 | Metagenome | 197 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0243238_1032711 | F026489 | GGA | MRSAGKVLLAEGCSLLVAKENQKTTSDFDALEPRKRGCSPLLTPKRRAIPEKTEDSRLFGVKIF |
⦗Top⦘ |