Scaffold Ga0183748_1008808

Overview

Basic Information

• Taxon OID: 3300029319
• Scaffold ID: Ga0183748_1008808
• Source Dataset Name: Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4356
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (27.27%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Jalkavirus → Jalkavirus S08C159 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Red Sea: TARA_032
• Coordinates
  • Lat. (^o): 23.36
  • Long. (^o): 37.2183
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055658	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183748_10088085	F055658	AGGAG	MPTKKPNKTKETPDTDVAKAIVSELGVNDTPAPYEPKVVKTKNGNTIIFN