Scaffold Ga0239302_100582

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0239302_100582

Scaffold Ga0239302_100582

Overview

Basic Information
Taxon OID	3300029314 Open in IMG/M
Scaffold ID	Ga0239302_100582 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Sewage Treatment Plant in Aalborg, Denmark - MBR_Gel1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aalborg University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	26490
Total Scaffold Genes	33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	22 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Comammox Microbial Communities From Various Environments And Locations In Europe

Source Dataset Sampling Location
Location Name	Denmark: Aalberg
Coordinates	Lat. (^o)	57.049957	Long. (^o)	9.865377	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006745	Metagenome	365	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0239302_10058227	F006745	N/A	MRTSQRDTRASSAVAVYVIILVAFQVFLLTVAVEAFATDDESLAWATAGVSIALAAGSAVLLRYLRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.