Scaffold Ga0134541_1001654

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134541_1001654

Scaffold Ga0134541_1001654

Overview

Basic Information
Taxon OID	3300029297 Open in IMG/M
Scaffold ID	Ga0134541_1001654 Open in IMG/M
Source Dataset Name	Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hong Kong
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11132
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Source Dataset Sampling Location
Location Name	Hong Kong
Coordinates	Lat. (^o)	22.3356	Long. (^o)	114.1826	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099451	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134541_100165423	F099451	N/A	MSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.