| Basic Information | |
|---|---|
| Taxon OID | 3300029297 Open in IMG/M |
| Scaffold ID | Ga0134541_1001654 Open in IMG/M |
| Source Dataset Name | Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hong Kong |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11132 |
| Total Scaffold Genes | 25 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hong Kong | |||||||
| Coordinates | Lat. (o) | 22.3356 | Long. (o) | 114.1826 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099451 | Metagenome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134541_100165423 | F099451 | N/A | MSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE |
| ⦗Top⦘ |