3300029297: Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0

Overview

Basic Information

• IMG/M Taxon OID: 3300029297
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121305 | Gp0151713 | Ga0134541
• Sample Name: Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hong Kong
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 215950181
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Hong Kong
• Coordinates
  • Lat. (^o): 22.3356
  • Long. (^o): 114.1826
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099451	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134541_1001654	Not Available	11132

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134541_1001654	Ga0134541_100165423	F099451	MSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE