Scaffold Ga0168113_1029205

Overview

Basic Information

• Taxon OID: 3300029242
• Scaffold ID: Ga0168113_1029205
• Source Dataset Name: Sewage sludge microbial communities from sewage treatment plant in Sweden - SWESTP1 - Uppsala-primary/surplus 102
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 951
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.844519
  • Long. (^o): 17.659844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041480	Metagenome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168113_10292052	F041480	N/A	LGLKGAKQLLSMDAASSKIRFVAKKDIVFFIKTSGDVIDLTSYIKLYEFVPVGQKREVTVTTKEGMLNNKEEAIGRLISFSVKMISKDNYQIQLPEQLAAGEYGFVWVKNMELKEFTVFAFGIDWKSSD