Basic Information | |
---|---|
Taxon OID | 3300029239 Open in IMG/M |
Scaffold ID | Ga0168092_1006213 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from sewage treatment plant in Sweden - SWESTP22 - Henriksdal-surplus 129 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3099 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 59.310676 | Long. (o) | 18.108437 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034611 | Metagenome / Metatranscriptome | 174 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0168092_10062134 | F034611 | N/A | MLQNKTILTLTIDLLANGAFNHLKDDEITAMHHLILRLKEPLSQVQQNLLITFWYHADISTLPSSLLYRCNTVLQQHGRYPLEEQLSTEMY |
⦗Top⦘ |