Scaffold Ga0168092_1006213

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168092_1006213

Scaffold Ga0168092_1006213

Overview

Basic Information
Taxon OID	3300029239 Open in IMG/M
Scaffold ID	Ga0168092_1006213 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from sewage treatment plant in Sweden - SWESTP22 - Henriksdal-surplus 129
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3099
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location Name	Sweden
Coordinates	Lat. (^o)	59.310676	Long. (^o)	18.108437	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034611	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168092_10062134	F034611	N/A	MLQNKTILTLTIDLLANGAFNHLKDDEITAMHHLILRLKEPLSQVQQNLLITFWYHADISTLPSSLLYRCNTVLQQHGRYPLEEQLSTEMY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.