Scaffold Ga0168092_1002168

Overview

Basic Information

• Taxon OID: 3300029239
• Scaffold ID: Ga0168092_1002168
• Source Dataset Name: Activated sludge microbial communities from sewage treatment plant in Sweden - SWESTP22 - Henriksdal-surplus 129
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6768
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.310676
  • Long. (^o): 18.108437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087352	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168092_10021683	F087352	N/A	MYHPNELIQDIQERLDRMVRDYRDIVEKNKKLETENKVLAHSLEEALKLQETLSKRLDTVSQETLRDTKGLDHWKTETRKEIRGIMKEVEKCIPQVESLLENK