Scaffold Ga0168092_1000707

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168092_1000707

Scaffold Ga0168092_1000707

Overview

Basic Information
Taxon OID	3300029239 Open in IMG/M
Scaffold ID	Ga0168092_1000707 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from sewage treatment plant in Sweden - SWESTP22 - Henriksdal-surplus 129
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14178
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (29.41%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location Name	Sweden
Coordinates	Lat. (^o)	59.310676	Long. (^o)	18.108437	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073180	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168092_10007073	F073180	N/A	MKQNFTYLQLTRLVYGETTKAETDMLLELAGTVPQIANSLEILTKGKEALGNDRFSPSEMVINRILGYSASSAPVSAS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.