Scaffold Ga0168116_1000140

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168116_1000140

Scaffold Ga0168116_1000140

Overview

Basic Information
Taxon OID	3300029233 Open in IMG/M
Scaffold ID	Ga0168116_1000140 Open in IMG/M
Source Dataset Name	Sewage sludge microbial communities from sewage treatment plant in Sweden - SWESTP59 - Uppsala-primary/surplus 201
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22616
Total Scaffold Genes	27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (70.37%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location Name	Sweden
Coordinates	Lat. (^o)	59.844519	Long. (^o)	17.659844	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006745	Metagenome	365	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168116_100014022	F006745	N/A	MRTSQRDTRASSAVAVYVIVLVAFQVFLLTVAVEAFATDDEPLAWATAGVSLALAAGSAVLLRYLRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.