Basic Information | |
---|---|
Taxon OID | 3300029210 Open in IMG/M |
Scaffold ID | Ga0168823_107435 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021221-45 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2534 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Beijing, Peking Union Medical College | |||||||
Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057001 | Metagenome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0168823_1074353 | F057001 | AGG | MTNKELNKVQNEVKKASEKTLTGAVKAWCQLFKSGKEINEILKENEIKVDKAIVPALVNLAKDKEVVIQLCKEILPRVNNTFCAYKEVDREYYDKNEQDKNKKLKMSEIEDIAILGSSHKRFGYNEPIEYDFGIYYETFNGADKRIIKCAVPIKRYTFNLIAKCVTYYLTHPKNDR |
⦗Top⦘ |