| Basic Information | |
|---|---|
| Taxon OID | 3300029202 Open in IMG/M |
| Scaffold ID | Ga0167843_104722 Open in IMG/M |
| Source Dataset Name | Polluted lake sediment microbial communities from Telengana, India - LAKES1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gothenburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2828 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Polluted Lake Sediment → Aquatic Microbial Community From Freshwater And Polluted Lake From Sweden And India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | India: Telengana | |||||||
| Coordinates | Lat. (o) | 17.5741667 | Long. (o) | 78.3563333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073597 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167843_1047224 | F073597 | GGAG | MDTGNFLLQGSQFFAGGNKYVFRRRKKPTVNKPPDYLIQLTPSFKYISSLFPAGEEGLYTFDFEKQVYVLKKEKEQVIITEGE |
| ⦗Top⦘ |