Scaffold Ga0167843_102716

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167843_102716

Scaffold Ga0167843_102716

Overview

Basic Information
Taxon OID	3300029202 Open in IMG/M
Scaffold ID	Ga0167843_102716 Open in IMG/M
Source Dataset Name	Polluted lake sediment microbial communities from Telengana, India - LAKES1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4123
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Polluted Lake Sediment → Aquatic Microbial Community From Freshwater And Polluted Lake From Sweden And India

Source Dataset Sampling Location
Location Name	India: Telengana
Coordinates	Lat. (^o)	17.5741667	Long. (^o)	78.3563333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077264	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167843_1027164	F077264	N/A	PPGPERFVHMALKLIWNLRADSAWIELVKVQAIETGRSSPGAFVRDLVWTLSKNPTIKNRIFEAMQGVQYGQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.