NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167512_104846

Scaffold Ga0167512_104846


Overview

Basic Information
Taxon OID3300029201 Open in IMG/M
Scaffold IDGa0167512_104846 Open in IMG/M
Source Dataset NameHuman oral microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002619-34
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4256
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location NameChina: Beijing, Peking Union Medical College
CoordinatesLat. (o)39.911947Long. (o)116.4156125Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084362Metagenome112N

Sequences

Protein IDFamilyRBSSequence
Ga0167512_1048468F084362GGAGGMSLMNCTFTVRWSDEKNKPHSKTYETEVAAKKAKKWPLEHGVRSVDIAVKINNKPAGSLQDSEKQPEAAAEQKGFWWEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.