| Basic Information | |
|---|---|
| Taxon OID | 3300029200 Open in IMG/M |
| Scaffold ID | Ga0120082_1002129 Open in IMG/M |
| Source Dataset Name | Biofilm microbial communities from University of Hong Kong - Biofilm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hong Kong |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2482 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029893 | Metagenome / Metatranscriptome | 187 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120082_10021296 | F029893 | AGGAG | MPVMQDSVSVAANSVSANVVAGQLYEFVPTGTKVTLSCTGSATGLRATLIANIPVMNDQAINLQNRFPIIPDDIVFQGAVRACRLVLTARNTTGGALTFFWRIDVN |
| ⦗Top⦘ |