Scaffold Ga0168647_101439

Overview

Basic Information

• Taxon OID: 3300029199
• Scaffold ID: Ga0168647_101439
• Source Dataset Name: Deep subsurface microbial communities from shale gas basins in Pennsylvania, USA - 1_Day0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7672
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (30.77%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Shale Gas Basins In Pennsylvania, Usa

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 39.898
  • Long. (^o): -79.976
  • Depth (m): 2517

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011477	Metagenome / Metatranscriptome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168647_1014395	F011477	GAGG	MSVAVIWAWVLANEAAVATILLIVSELLGAVPQVKSNGLASFVILQVRKVLENKGAKDPT