NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168647_101050

Scaffold Ga0168647_101050


Overview

Basic Information
Taxon OID3300029199 Open in IMG/M
Scaffold IDGa0168647_101050 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from shale gas basins in Pennsylvania, USA - 1_Day0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9980
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (69.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Shale Gas Basins In Pennsylvania, Usa

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)39.898Long. (o)-79.976Alt. (m)Depth (m)2517
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035276Metagenome / Metatranscriptome172Y
F048267Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0168647_10105015F048267GGAGGMTDEEWETSLKSMNEEAKKRVDEEIDKIKYNVVKEIINRELKND
Ga0168647_10105020F035276GGAMTKSYISCYNNETKELEHFEVPYSIFVYIRQLEDEIKYASGGVKRLYPFRFGEEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.