| Basic Information | |
|---|---|
| Taxon OID | 3300029189 Open in IMG/M |
| Scaffold ID | Ga0168060_120820 Open in IMG/M |
| Source Dataset Name | Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg49 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Liverpool |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 895 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Synthetic → Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | United Kingdom: Liverpool | |||||||
| Coordinates | Lat. (o) | 53.405936 | Long. (o) | -2.9677609 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010244 | Metagenome / Metatranscriptome | 306 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168060_1208202 | F010244 | AGAAGG | VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL |
| ⦗Top⦘ |