NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029189

3300029189: Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg49



Overview

Basic Information
IMG/M Taxon OID3300029189 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127414 | Gp0192446 | Ga0168060
Sample NameSynthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg49
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Liverpool
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79836361
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSynthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom
TypeEngineered
TaxonomyEngineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Synthetic → Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUnited Kingdom: Liverpool
CoordinatesLat. (o)53.405936Long. (o)-2.9677609Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010244Metagenome / Metatranscriptome306Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0168060_120820All Organisms → cellular organisms → Bacteria895Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0168060_120820Ga0168060_1208202F010244VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.