| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029189 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127414 | Gp0192446 | Ga0168060 |
| Sample Name | Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg49 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Liverpool |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 79836361 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom |
| Type | Engineered |
| Taxonomy | Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Synthetic → Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | United Kingdom: Liverpool | |||||||
| Coordinates | Lat. (o) | 53.405936 | Long. (o) | -2.9677609 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010244 | Metagenome / Metatranscriptome | 306 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0168060_120820 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0168060_120820 | Ga0168060_1208202 | F010244 | VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL |
| ⦗Top⦘ |