| Basic Information | |
|---|---|
| Taxon OID | 3300029183 Open in IMG/M |
| Scaffold ID | Ga0168032_118689 Open in IMG/M |
| Source Dataset Name | Aquariaum water viral communities from Chicago, USA - Caribbean Reef - CR2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Michigan State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 548 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Chicago | |||||||
| Coordinates | Lat. (o) | 41.87 | Long. (o) | -87.61 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046981 | Metagenome / Metatranscriptome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168032_1186891 | F046981 | AGGAG | MALGIEQIDDFVASIHQKFAGEDRRAAQDISLPLQNYKYASRLFDNNLTKDTMSTSQCKWKLKVRTNDNFQVVGLYHRDSSNRVNVLDEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYLEDMERDLMTSFYTGMEDLIFGPGPSSPTATPFPPVIVTGK |
| ⦗Top⦘ |