NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046981

Metagenome / Metatranscriptome Family F046981

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046981
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 199 residues
Representative Sequence MALGIEQIDDFVNSIHQKFAGEEMLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQAKWKVKVNTNDNFQVVGLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGW
Number of Associated Samples 112
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 70.00 %
% of genes near scaffold ends (potentially truncated) 99.33 %
% of genes from short scaffolds (< 2000 bps) 90.67 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Clay → Unclassified → Soil
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(24.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(32.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.31%    β-sheet: 5.14%    Coil/Unstructured: 63.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF07618DUF1580 0.67
PF13392HNH_3 0.67



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001866|JGI24729J20445_1008704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2580Open in IMG/M
3300002124|C687J26631_10218384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium633Open in IMG/M
3300002171|JGI24732J26686_1039572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium832Open in IMG/M
3300002503|C687J35164_10243025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium513Open in IMG/M
3300002514|JGI25133J35611_10143911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium660Open in IMG/M
3300002518|JGI25134J35505_10033590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1416Open in IMG/M
3300004112|Ga0065166_10174208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium834Open in IMG/M
3300004457|Ga0066224_1110183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium638Open in IMG/M
3300005294|Ga0065705_10517641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium765Open in IMG/M
3300005294|Ga0065705_11146264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium512Open in IMG/M
3300005365|Ga0070688_100195445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1412Open in IMG/M
3300005417|Ga0068884_1341419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium665Open in IMG/M
3300005441|Ga0070700_101665404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium546Open in IMG/M
3300005590|Ga0070727_10365191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium804Open in IMG/M
3300005613|Ga0074649_1020846All Organisms → Viruses → Predicted Viral3721Open in IMG/M
3300005656|Ga0073902_10349952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium648Open in IMG/M
3300005664|Ga0073685_1035382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1435Open in IMG/M
3300005664|Ga0073685_1037760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1381Open in IMG/M
3300005664|Ga0073685_1065297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium997Open in IMG/M
3300005664|Ga0073685_1144981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium609Open in IMG/M
3300005664|Ga0073685_1194556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium502Open in IMG/M
3300005683|Ga0074432_126767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium830Open in IMG/M
3300005961|Ga0075157_10077333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1400Open in IMG/M
3300006056|Ga0075163_11590281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium630Open in IMG/M
3300006738|Ga0098035_1165932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium746Open in IMG/M
3300006754|Ga0098044_1067068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1504Open in IMG/M
3300006805|Ga0075464_10926496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium545Open in IMG/M
3300006918|Ga0079216_10841216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium681Open in IMG/M
3300007233|Ga0075178_1412302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1131Open in IMG/M
3300007276|Ga0070747_1221073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium663Open in IMG/M
3300007319|Ga0102691_1577306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium684Open in IMG/M
3300007345|Ga0070752_1401715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium506Open in IMG/M
3300007516|Ga0105050_10304709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium972Open in IMG/M
3300007960|Ga0099850_1132940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1010Open in IMG/M
3300008470|Ga0115371_11269641All Organisms → Viruses → Predicted Viral1105Open in IMG/M
3300009085|Ga0105103_10686633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium588Open in IMG/M
3300009091|Ga0102851_12905102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium550Open in IMG/M
3300009100|Ga0075418_10446147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1386Open in IMG/M
3300009165|Ga0105102_10343554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium782Open in IMG/M
3300009165|Ga0105102_10635991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium593Open in IMG/M
3300009169|Ga0105097_10200507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1099Open in IMG/M
3300009177|Ga0105248_12234169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium623Open in IMG/M
3300009285|Ga0103680_10190705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1094Open in IMG/M
3300009537|Ga0129283_10160790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium932Open in IMG/M
3300009622|Ga0105173_1054120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium681Open in IMG/M
3300009654|Ga0116167_1216705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium631Open in IMG/M
3300009678|Ga0105252_10233342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium800Open in IMG/M
3300009706|Ga0115002_10655652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium745Open in IMG/M
3300009941|Ga0132240_1053356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium596Open in IMG/M
3300010338|Ga0116245_10182697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1157Open in IMG/M
3300010368|Ga0129324_10318133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium610Open in IMG/M
3300010392|Ga0118731_110467519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium552Open in IMG/M
3300011405|Ga0137340_1012660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1524Open in IMG/M
3300011415|Ga0137325_1142081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium550Open in IMG/M
3300011445|Ga0137427_10253722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium737Open in IMG/M
3300012038|Ga0137431_1104623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium796Open in IMG/M
3300012714|Ga0157601_1105439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium676Open in IMG/M
3300012720|Ga0157613_1146942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium543Open in IMG/M
3300012724|Ga0157611_1245321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium581Open in IMG/M
3300012956|Ga0154020_11273405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium552Open in IMG/M
3300013101|Ga0164313_11576095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium529Open in IMG/M
3300013118|Ga0171656_1052392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2427Open in IMG/M
(restricted) 3300013125|Ga0172369_10138554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1498Open in IMG/M
(restricted) 3300013128|Ga0172366_10124551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1701Open in IMG/M
(restricted) 3300013136|Ga0172370_10425809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium722Open in IMG/M
(restricted) 3300013137|Ga0172375_10156896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1839Open in IMG/M
(restricted) 3300013138|Ga0172371_10039131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium5180Open in IMG/M
3300013232|Ga0170573_10900062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium999Open in IMG/M
3300014059|Ga0119868_1162716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium628Open in IMG/M
3300014205|Ga0172380_10294891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1237Open in IMG/M
3300014205|Ga0172380_10346540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1122Open in IMG/M
3300014205|Ga0172380_11038284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium579Open in IMG/M
3300014206|Ga0172377_10164264All Organisms → Viruses → Predicted Viral1967Open in IMG/M
3300014613|Ga0180008_1141843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium933Open in IMG/M
3300014613|Ga0180008_1234304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium701Open in IMG/M
3300014613|Ga0180008_1241808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium689Open in IMG/M
3300014613|Ga0180008_1333481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium574Open in IMG/M
3300014613|Ga0180008_1383964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium530Open in IMG/M
3300014613|Ga0180008_1400847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium518Open in IMG/M
3300014656|Ga0180007_10662101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium621Open in IMG/M
3300014656|Ga0180007_10770841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium568Open in IMG/M
3300014811|Ga0119960_1024803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium815Open in IMG/M
3300017718|Ga0181375_1043764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium748Open in IMG/M
3300017991|Ga0180434_10170086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1764Open in IMG/M
3300018080|Ga0180433_10707150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium749Open in IMG/M
3300020057|Ga0163151_10507044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium581Open in IMG/M
3300020109|Ga0194112_10293915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1236Open in IMG/M
3300020219|Ga0163146_10169460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1415Open in IMG/M
3300020221|Ga0194127_10608376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium695Open in IMG/M
3300020221|Ga0194127_10954069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium518Open in IMG/M
3300022307|Ga0224507_10285531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium663Open in IMG/M
3300022413|Ga0224508_10406065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium859Open in IMG/M
3300025082|Ga0208156_1000419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium17009Open in IMG/M
3300025141|Ga0209756_1014959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium4786Open in IMG/M
3300025687|Ga0208019_1176982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium578Open in IMG/M
3300027705|Ga0209063_1216129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium644Open in IMG/M
3300027789|Ga0209174_10270202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium750Open in IMG/M
3300027814|Ga0209742_10301151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium528Open in IMG/M
(restricted) 3300027881|Ga0255055_10675048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium551Open in IMG/M
3300027917|Ga0209536_100715407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1243Open in IMG/M
(restricted) 3300027996|Ga0233413_10249887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium754Open in IMG/M
3300028599|Ga0265309_10867472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium619Open in IMG/M
3300028920|Ga0272441_10791420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium736Open in IMG/M
3300029183|Ga0168032_118689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium548Open in IMG/M
3300029288|Ga0265297_10258020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1235Open in IMG/M
3300031281|Ga0307420_1278104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium505Open in IMG/M
3300031539|Ga0307380_10306129All Organisms → Viruses → Predicted Viral1472Open in IMG/M
3300031539|Ga0307380_10359615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1327Open in IMG/M
3300031539|Ga0307380_10518043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1045Open in IMG/M
3300031539|Ga0307380_10682671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium869Open in IMG/M
3300031539|Ga0307380_11448122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium515Open in IMG/M
3300031565|Ga0307379_10081103All Organisms → Viruses → Predicted Viral3583Open in IMG/M
3300031565|Ga0307379_10147384All Organisms → Viruses → Predicted Viral2478Open in IMG/M
3300031565|Ga0307379_10346380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1445Open in IMG/M
3300031565|Ga0307379_10406571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1303Open in IMG/M
3300031565|Ga0307379_10483802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1163Open in IMG/M
3300031565|Ga0307379_10523977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1103Open in IMG/M
3300031565|Ga0307379_10708836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium902Open in IMG/M
3300031565|Ga0307379_10718359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium894Open in IMG/M
3300031565|Ga0307379_11334664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium584Open in IMG/M
3300031565|Ga0307379_11493423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium539Open in IMG/M
3300031566|Ga0307378_10095437All Organisms → Viruses → Predicted Viral3114Open in IMG/M
3300031566|Ga0307378_10324056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1446Open in IMG/M
3300031566|Ga0307378_10349709All Organisms → Viruses → Predicted Viral1376Open in IMG/M
3300031566|Ga0307378_10498943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1092Open in IMG/M
3300031566|Ga0307378_10718568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium855Open in IMG/M
3300031566|Ga0307378_10722256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium852Open in IMG/M
3300031578|Ga0307376_10324247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1025Open in IMG/M
3300031578|Ga0307376_10542990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium747Open in IMG/M
3300031673|Ga0307377_10246564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1372Open in IMG/M
3300031673|Ga0307377_10549521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium834Open in IMG/M
3300031772|Ga0315288_11434303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium575Open in IMG/M
3300031784|Ga0315899_11751677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium508Open in IMG/M
3300031786|Ga0315908_10070957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2726Open in IMG/M
3300031803|Ga0310120_10022051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium3900Open in IMG/M
3300031804|Ga0310124_10610656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium627Open in IMG/M
3300031857|Ga0315909_10070249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium3134Open in IMG/M
3300031963|Ga0315901_10488956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium962Open in IMG/M
3300032050|Ga0315906_10027888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium6161Open in IMG/M
3300032050|Ga0315906_10451190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1103Open in IMG/M
3300032092|Ga0315905_10956083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium726Open in IMG/M
3300032820|Ga0310342_100036989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium3989Open in IMG/M
3300033407|Ga0214472_10617274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium994Open in IMG/M
3300033407|Ga0214472_11772359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium520Open in IMG/M
3300033485|Ga0316626_10629761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium928Open in IMG/M
3300033485|Ga0316626_11991766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium526Open in IMG/M
3300033521|Ga0316616_103558665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium587Open in IMG/M
3300034063|Ga0335000_0392717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium827Open in IMG/M
3300034104|Ga0335031_0351108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium942Open in IMG/M
3300034656|Ga0326748_013013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1087Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil16.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.00%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater5.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.67%
AquaticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic3.33%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.33%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.33%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate3.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.67%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.67%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.33%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.33%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.33%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.33%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.33%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.33%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.33%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.33%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge1.33%
Bioremediated Contaminated GroundwaterEngineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater1.33%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.67%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.67%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.67%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.67%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.67%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.67%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.67%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.67%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.67%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.67%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.67%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.67%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.67%
Filtered SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater0.67%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.67%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.67%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.67%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.67%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.67%
Aquarium WaterEnvironmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.67%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.67%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.67%
Lab-Scale Ebpr BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001866Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23EngineeredOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300002171Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23EngineeredOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300005656Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-KitEngineeredOpen in IMG/M
3300005664Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USAEnvironmentalOpen in IMG/M
3300005683Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91802 Phage SequencingEngineeredOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007233Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007319Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009285Microbial communities from groundwater in Rifle, Colorado, USA - 2A_0.1umEnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009622Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155EnvironmentalOpen in IMG/M
3300009654Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaGEngineeredOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009941Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, 12m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010338AD_JPMRcaEngineeredOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012714Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013118Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300013125 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25mEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013136 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013138 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12mEnvironmentalOpen in IMG/M
3300013232Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1EngineeredOpen in IMG/M
3300014059Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Membrane foulantsEngineeredOpen in IMG/M
3300014205Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaGEngineeredOpen in IMG/M
3300014206Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaGEngineeredOpen in IMG/M
3300014613Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaGEnvironmentalOpen in IMG/M
3300014656Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaGEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020219Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300022307Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13EnvironmentalOpen in IMG/M
3300022413Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027705Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes)EngineeredOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028920Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6NEnvironmentalOpen in IMG/M
3300029183Aquariaum water viral communities from Chicago, USA - Caribbean Reef - CR2EnvironmentalOpen in IMG/M
3300029288Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91EngineeredOpen in IMG/M
3300031281Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-40EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031803Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983EnvironmentalOpen in IMG/M
3300031804Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034656Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24729J20445_100870413300001866Bioremediated Contaminated GroundwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDASTRVNVLDEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLENDLLTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPLGW
C687J26631_1021838413300002124SoilMGLGIEQIDDFVNSIHQRYAGEEKLAAQDISLPLQHYKYASRLFDPAGKNVMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPVQSPFPPVSLLWWITATDDSTTENNSEEGFDGYAPLGWGSNGVGGIDP
JGI24732J26686_103957213300002171Bioremediated Contaminated GroundwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDASTRVNVLDEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLENDLLTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPLGWGSNGAGGXSCTTYPQ
C687J35164_1024302513300002503SoilDISSPLQEYMFASRLFDSANKREMSTSQCKWKLKVANNDNFQVVGLYHRDSSSRVNVLTEGAMKWGMTTTNYHYDIDEETFAQGADAIVDYLNLQEQGLMQDFFEGIEDLMFSAGPTSPTQSPFPPVSLLHWITSTDDSTTENNSEEGFDGYEPVGFGSVGVGGISCTTY
JGI25133J35611_1014391113300002514MarineMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTATNDNFQVVGLYHRDSSSRVNVLNEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPGSSTVSPFPPVSLLWWITSTDDSVTENNSEEGFDGYEPVGWTDVGGIDPSTFDQWRNRTFP
JGI25134J35505_1003359013300002518MarineMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTATNDNFQVVGLYHRDSSSRVNVLNEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPGSSTVSPFPPVSLLWWITSTDDSVTENNSEEGFDGYEPVGWTDVGGIDPSTF
Ga0065166_1017420813300004112Freshwater LakeMALSIEQIDDFVNSIQQKFAGEERLAAQDLSLPLQSYKYASRLFSGNLKKDTMSTSQCKWKIKVNTNDNFQTVGLYHRDSSTRVNTLDEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEGLEQDLMTSFYTGMEDLIFGPGPVGPTQSPFSVASLLWWITATNDSVSENNAPEGFNGFEPVGWGANGVGGISCTTYPQWRNRTFPYTTVSRSDFVEKTIVSMDLCQFTPPVQRPDIVDQTRSDWELLTTHSVLSANRRLLQLGNDN
Ga0066224_111018313300004457MarineMALGIEQIDDFVNSIHQKYTGEEKLAAQDISLPLQKYKYASRLFDPMMKNEMSTSLCKFKLKVRTNDNFQVVGLYHRDTSDRVNVLDEGQLKWGRTTNNYHGDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATNDAVTENNSTEGFNGYAPVG
Ga0065705_1051764113300005294Switchgrass RhizosphereASRLFSGDLKKDTMATSQCKWKIKVATNDNFQVVGLYHRDSSDRVNVLSEGSSKWSMTTNNYHYDIDEEIFQTGGKQIYDYLESLERDLMTSFYTNMEDQMFGAGPTSPSQSPYPPLSLLHWITSTDDSTTENNSEEGFDGYAPLGFGSVGVGNIDPIVYDQWRNRTFPYTTVDRADFIEKTINSMDMCYFQPPVERPDVVAQKKPKWELLTTHSRIAQARQLLQLGNDNIGDDLAAHSGAVYIRGVPMVWIPA
Ga0065705_1114626413300005294Switchgrass RhizosphereSHMALGIEQIDDFVNSIHQKFAGEERLAAQDISLPLQNYKYASRLFDKNLSKDTMSTSQCKYKLKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITSTDDS
Ga0070688_10019544523300005365Switchgrass RhizosphereMALGIEQIDDFVNSIHQKYFGEEQGRAQDISKPLQKYKFASRLFDAAKKDEMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWSLTTNNYHYDIDEEIFRAGGKQIYDYIKGLEDDLMDSFYMGMEDQLFGAGPSSPTQSPFPPVSLLWWITSTSDSVTENNATEGFTGREPLGWSSSGVGGISTTTYDQWRNRVFSYTTVDRDDFI
Ga0068884_134141923300005417Freshwater LakeMALSIEQIDDFVNSIQQKFAGEESLAAQDLSLPLQSYKYASRLFSGNLKKDTMSTSQCKWKIKVNTNDNFQTVGLYHRDSSTRVNTLDEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEGLEQDLMTSFYTGMEDLIFGPGPTGPTQSPFSVASLLWWITST
Ga0070700_10166540413300005441Corn, Switchgrass And Miscanthus RhizosphereRLFNKAMKREMSTSQCKWKIKVRNNDNFQVVGLYHRDSSNRVNVLDEGSLKWGLTTTNYHYDIDEEIFKQGADQIVDYMNLQEQGLMQDFFTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYAPLGWGANGVGGISPITYDQWRNRTFPYTVVDRADFVEKTI
Ga0070727_1036519123300005590Marine SedimentMALGIEQIDDFVASYLQKYPMGKWQDISSPLQKYYFASRIFDKGTKRQMSTSQAKWKIKVRNNSNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTTNYHYDIDEEIFKQGADEIVNYMNLQEQGLMQDFFEGMENLMFGPGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFD
Ga0074649_102084613300005613Saline Water And SedimentMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLFHRDSSSRVNVLSEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLESDLLTSFYTGMEDLMFGSGPSSSTQSPFPPVSLLWWITSTDDSVTENNAEEGFNGDAPVNWADVGGINPATYSQWKNRTFPYVTVDRADFVEKTINSMDLCQFQPPVQRPDIVDQ
Ga0073902_1034995213300005656Activated SludgeIMALGIDQIDDFVASIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFAPVGLYHRDSSTRVSTLSEGELKWALTTNNYHYDIDEEIFQTGGRQIYDYIESMERDLMTSFYAGMEDLMFGPGPTGPTQTPFTVASLLWWITATDDSITENNSEEGFDGYAPVGWGASGVGGIDPTVYDQWRNRTFPYTNVDR
Ga0073685_103538223300005664AquaticMALGIEQIDDFVNSIHQKFAGEEYLAAQDLSLKLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDMNDNFQVVGLYHRDSSTRVNTLSEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEEMERDLMTSFYTGMEDLMFGGGPVGPTQSPFSPASLLWWITSTSDSVTENNALEGFNGFEPVGWGSNGVGGISCTDYPQWRNRTFPYVDVNRNDFVEKVINSMDLCSFTPPVQRPDIVDQKQHNWELLTT
Ga0073685_103776013300005664AquaticMALGIEQIDDFVNSIHQKFAGEDMLAAQDISLPLQEYKYASRLFSGNLKKDTMATSQCKWKVKVNTNDNFQVVGLYHRDSSSRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQTPFPPVSLLWWITATDDSTTENNSEEGFDGYAPVGWGSNGVGGIDPSVYDQWRNRTFPYTNVDRDDFVEKIINSMDLCSFTPPVQR
Ga0073685_106529723300005664AquaticVGLGIEQIDDFVNTIHQEFAGQERLAAQDISLPLQEYKYASRLFSGNLQKDSMSTSQCKWKVKVATNNNFQVVGLYHRDSSGRVNTISEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYIKGMEDDLMTSFYQGMEDLMFGAGPSGPTQDPFSPVSLLWWITATDDSTTENNSEEGFDGYAPVGWGSNGVGGIDPIAYDQWRNRTFPYAEVTREDFVEKIINSMDLCSFTPPVSRPDIVSQTSNDWELL
Ga0073685_114498113300005664AquaticLSIDQIDDFVNSIHQKFAGEDMLAAQDISLPLQEYKYASRLFSGNLEKDTMSTSQCKWKVKVATNDNFQVVGLYHRDSSSRINTLSEGSLKWGLTTNNYHYDIDEEIFQTGGKQIYDYLKAMETDLMTSFYTGMEDLMFGPGPSGPTVNPFPPVSLLWWITATDDSTSENNSEEGFDGYAPVGWGSNGVGGIDPTVYDQWRN
Ga0073685_119455613300005664AquaticISLPLQKYKYASRLFSGNLKKDTMSTSQAKWKVKVNTNDNFQVVGLYHRDSSGRVNTLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQTPFPPVSLLWWITATDDSTTENNSEEGFDGYAPVGWGANGVGGIDP
Ga0074432_12676723300005683Lab-Scale Ebpr BioreactorMALGIEQIDDFVNSILQKFAGEERMAAQDISLPLQKYKYASRLFSGNIQKDTMSTSQCKWKVKIATNDNFQPVGLYHRDSSSRVNTLIEGSMKWALTTNNYHYDIDEEIFQTGGKQIYDYLKGLEDDLMTSFYTGMEDLMFGPGPSXXXXXXXXXXXLLWWITATDDSVSENNSEEGFDGYAPVGWGSNGVGGIDPIVYD
Ga0075157_1007733313300005961Wastewater EffluentMALGIEQIDDFVNSIHQKFAGEEYLAAQDLSLKLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDMNDNFQVVGLYHRDSSTRVNTLSEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEEMERDLMTSFYTGMEDLMFGGGPVGPTQSPF
Ga0075163_1159028113300006056Wastewater EffluentMGLSIDQIDDFVNSIHQKFAGEEMLAAQDLSLPLQEYKYASRLFSGNLEKDTMSTSQCKWKVKVATNDNFQVVGLYHRDSSSRINTLSEGSLKWGLTTNNYHYDIDEEIFQTGGKQIYDYLKAMETDLMTSFYTGMEDLMFGPGPSGPTVNPFPPCSLLWWITATDDSVSENNSEEG
Ga0098035_116593213300006738MarinePLQEYYFASRLFDKGTKREMSTSQCKWKVKVDNNDNFQVVGLYHRDSSDRVNVLTEGSLKWGLTTTNYHYDIDEEIFKQGADQIVDYMNLQEQGLMQDFFEGMENLMFGAGPTSPTQSPFPPCSLLWWITSTSDSTTENNATEGFTGVEPLGWDGSGVGGIDPDTYAQWKNRAFPYTTVDRDDFVEKTINSMDLCTFKPPVSRSDIKPEGKHRWELLTTHSRVAASRRLLQLSNDNIQDDLAAHSGSV
Ga0098044_106706813300006754MarineMALGIEQIDDFVASYLQKYPMGKWQDISSPLQEYYFASRLFDKGTKREMSTSQCKWKVKVDNNDNFQVVGLYHRDSSDRVNVLTEGSLKWGLTTTNYHYDIDEEIFKQGADQIVDYMNLQEQGLMQDFFEGMENLMFGAGPTSPTQSPFPPCSLLWWITSTSDSTTENNATEGFTGVEPLGWDGSGVGGIDPDTYAQWKNRAFPYTTVDRDDFVEKTINSMDLCTFKPPVSRSDIKPEGKHRWELLTTHS
Ga0075464_1092649613300006805AqueousMALGIEQIDDFVNSIHQKYFGEEQGRAQDISKPLQKYKFASRLFDAAKKDEMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWGMTTNNYHYDIDEEIFRAGGRQIYDYIKGLEDDLMDSFYMGMEDQLFGAGPASPTQSPFPPVSLLWWIT
Ga0079216_1084121613300006918Agricultural SoilRLAAQDISLPLQSYKYASRLFDSNLKKDTMSTSQCKFKLKVSTNDNFQVVGLYHRDSSDRVNVLSEGSLKWCLTTNNYHYDIDEEIFRTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPTSPTQSPFPPVSLLWWITSTDDSLSENNAEEGFDGVEPVGWGSAGVGGISTATYDQWKNRTFPYTTIDRDDFIEKTINSMDLAQFEPPVEGNKDIVPQGKPNWEL
Ga0075178_141230223300007233Wastewater EffluentMALGIEQIDDFVNSIHQKFAGEEYLAAQDLSLKLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDMNDNFQVVGLYHRDSSTRVNTLSEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEEMERDLMTSFYTGMEDLMFGGGPVGPTQSPFSPASLLWWITSTSDSVTENNALEGFNGFEPVGWGSNGVGGISCTDYPQWRNRTFPYVDVNRNDFVEKVINSMDLCSFTPPVQRPDIVDQKQHNWELLTTHSVLAQGR
Ga0070747_122107313300007276AqueousFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLQKDTMSTSQCKWKVKVDTNDNFQVVDLYHRDSSTRVNVMDEGNLKWGLTTNNYHYDIDEEIFRTGGRQIYDYLESLEQDLMTSFYTGMEDLMFGGGPASPTQSPFPPVSLLWWITATDDSTSENN*
Ga0102691_157730613300007319Freshwater LakeMALSIEQIDDFVNSIHQKFAGEEMLAAQDLSLSLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQTVGLYHRDSSTRVNTLDEGELKWALTTNNYHYDIDEEIFRTGGKQIYDYIEDMERDLMTSFYTGMEDLVFGPGPTAPTQTPFSVASLLWWITATNDS
Ga0070752_140171513300007345AqueousIEQIDDFVAGIHQKFAGEERLAAQDISLPLQSYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHEDSSTRVSVLQEGSLKWGPTTNNYHYDIDEEIFQTGGRQIYDYLESLEQDLMTSFYTGMEDLIFGPGPGSSTVSPFPPVSLLWWITATDDSITEN
Ga0105050_1030470913300007516FreshwaterMALSVKQIDDLVASMHQRFEGEEKHAAQDLSLPLQEYMFASRLFDKAQKSAISGTECKWKLKVDYQDNFQVVGLYHRDSSDRVNVLTEGNMPWGMTTNNYHYDIRENVFQQEGDIIYDYITDHERDLMTSFYVGMENLMFGPGPASPTQTPFPPVSLLHWITSTSDSVTENNATEGFTGAEPVGWGSSGVGGVSTSQYDQWKNRVFPYTTVDRSDLIKKTIRSMDLCNFKPPVERPDIVKQGRPNWELLTTHS
Ga0099850_113294013300007960AqueousMAFGIEQIDDFVASIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNTLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYIESMEHDLLTSFYAGMEDLMFGSGPSSSTQSPFPPVSLLWWITATDDSTSENNSEEG
Ga0115371_1126964123300008470SedimentMALAIHQLDDFIQAYYQKRIEGSWQDISSVLQEYMYASRIFNQAARRPMVTSRAKWKLKVDNNDNFKIVGLYHRDSSSRVNVLQEGTMDWGLSTTNYHFDIDEEVFTQGATAIVDYLELQEQGLMQDYFTGMEDVMFGAGPSGPLVSPFPPVSLLHWITSTDD
Ga0105103_1068663323300009085Freshwater SedimentMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDASTRVNVLAEGELKWGLTTNNYHYDIDEEIFRVGGRQIYDYIESLERDLVTSFYTGMEDLMFGPGPSSA
Ga0102851_1290510213300009091Freshwater WetlandsECMFASRLFDSANKKEMSTSQCKWKLKVANNDNFQVVGLYHRDSSSRVNVLTEGSLKWGMTTTNYHYDIDEETFAQGADAIVDYMNLQEQGLMQDFFAGIEDLMFGPGPSSPTQSPFPPVSLLHWITSTDDSTTENNSEEGFDGYEPLGFGSVGVGGISCTTYEQWRNRTFPYVTVDRDDFV
Ga0075418_1044614713300009100Populus RhizosphereMALGIEQIDDFVNSIHQRYAGEEKLAAQDISLPLQKYKYASRLFDPMGKNVMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGKQIYDYIESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITSTDDSVTENNSEEGFDGFEPLGWGSNGVGGISAVTYDQWRNRTFPYTVVDRDDFVEKTINSMDLCQFEPPVQRPDIVAQGKPNWELLTTHSRLAQCRRL
Ga0105102_1034355413300009165Freshwater SedimentMALSIEQIDDFVNSIHQKFAGEERLAAQDLSLTLQEYMYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQTVGLYHRDSSGRVNTLSEGSMKWALTTNNYHYDIDEEIFRTGGKEIYDYLKGQEDDLMTSFYTGMEDLVFGPGPTGPTQSPFTVASLLWWITSTNDSITENNAPEGFNGFEPVGWGANGV
Ga0105102_1063599113300009165Freshwater SedimentMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDASTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYLASLEDDLVTSFYTGMEDLMFGPGPTSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWDS
Ga0105097_1020050723300009169Freshwater SedimentMALGIEQIDDFVNSIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNIKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSSRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMASFYAGMEDLMFGPGPSSPTQSPFPPVSLLWWIIATDDSTTENNSEEGFDGYAPVGWGDNGVGGIDPRVYDQWRNRTFPYVNVDREDFVEKVINSMDLC
Ga0105248_1223416913300009177Switchgrass RhizosphereMALGIEQIDDFVNGIHQKYFGEEQGRAQDISKPLQKYKFASRLFDAAKKDEMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWSLTTNNYHYDIDEEIFRAGGRQIYDYIKGLEDDLMDSFYMGMEDQLFGAGPSSPTQSPFPPVSLLWWITSTSDSVTENNATE
Ga0103680_1019070523300009285GroundwaterMALGIEQIDDFVNGIHQKFAGEERLAAQDISLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLERDLVTSFYTGMEDLMFGPGPASPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPLGWGSNGVGGLSCTTYAQWRNRTFPYTTVDRADFVEKVINSMDLCQFEPPVERPDIVNQKRSDWELLT
Ga0129283_1016079023300009537Beach Aquifer PorewaterMALGIEQIDDFVNSIHQKFTGEDRRAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTNTNDNFQVVGLYHRDSSSRVNVLTEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYLADLERDLMTSFYTGMEDLMFGPGPSSPTQTPFPPVSLLWWITSTDDSLTENNSEEGFDGFSPVGWGATGVGGISTTTYDQWRNRTFPY
Ga0105173_105412013300009622Marine OceanicMALGIEQIDDFVASTLQAFPMGKWQDISSPLQEYYFASRLFDKGTKKEMATSQVKWKIKVRNNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLSTVNYHYDIDEEIFKQGPLEIVDYLQLQEQGLMQDFFEGMENLMFGAGPTSPTQSPFPPVSLLWWITATDDSASENNSEEGFDGYEPV
Ga0116167_121670523300009654Anaerobic Digestor SludgeMALSIDQIDDFVNSIHQRFAGEDMLAAQDISLPLQEYKYASRLFSGNLEKDTMSTSQCKWKIKVGTNNNFQVVGLYHRDTSGRINTISEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLKGQETDLMTSFYQGMEDLMFGPGPSG
Ga0105252_1023334213300009678SoilMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFDKSLKKDTMSTSQCKFKLKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLERDLMTSFYTGMEDLMFGPGPSSPVQSPFPPVSLLWWITSTDDSTTENNSEEGFDGYEPLGWGSNGVGGISAGTYDQWRNRT
Ga0115002_1065565213300009706MarineMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKFKIKVATNDNFQVVGLYHRDSSTRVNVLTEGGLKWGLTTNNYHYDIDEEIFRTGGRQIYDYIEDMERDLMTSFYTGMEDIIFGAGPTGPSQSPFPPVSLLWWITATDDSTTENN
Ga0132240_105335613300009941Meromictic PondMALGIEQIEDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNVLGEGELKWGLTTNNYHYDIDEEIFRTGGRQVYDYIESLESDLLTSFYTGMEDLMFGPGPSSATQSPFPPVSLLWWITDTDDSVTEGN
Ga0116245_1018269713300010338Anaerobic Digestor SludgeMALSIDQIDDFVNSIHQRFAGEDMLAAQDISLPLQEYKYASRLFSGNLEKDTMSTSQCKWKIKVGTNNNFQVVGLYHRDSSGRINTTSEGSLRWGLTTNNYHYDIDEEIFQTGGRQIYDYLKGQETDLMTSFYQGMEDLMFGPGPSGPTADPFPPVSLLWWITATDDSLTENNSEEGFDGYAPVGWGSNGVGGIDPTVY
Ga0129324_1031813313300010368Freshwater To Marine Saline GradientMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSSRVNVLTEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEE
Ga0118731_11046751913300010392MarineMALGVEQIDDFVAGIHQKFAGEERLAAQDISLPLQHYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHKDTTTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLEQDLMTSFYTGMEDVIFGAGPASSTTSPFPPVSLLWWITATDD
Ga0137340_101266013300011405SoilMALGIEQIDDFVNSIHQKFAGEERLAAQDISLPLQSYKYASRLFDSNLKKDTMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPVQSPFPPVSLLWWITSTDDSTTENNSEEGFDGFEPVG
Ga0137325_114208113300011415SoilAAQDISLPLQHYKYASRLFDPAGKNVMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGALKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPVQSPFPPVSLLWWITSTDDSTTENNSEEGFDGYEPVGWSGNGVGGISASTYDQWRNRTFPY
Ga0137427_1025372223300011445SoilMALGIEQIDDFVNSIHQKFAGEERLAAQDISLPLQSYKYASRLFDSNLKKDTMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPVP
Ga0137431_110462313300012038SoilMALGIEQIDDFVNSIHQRYAGEEKLAAQDISLPLQHYKYASRLFDPAGKNVMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGALKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPVQSPFPPVSLLWWITSTDDSTTENNSEEGFDGYEPVGWSGNGVGGISASTYDQWRNRTFPYTVVDRDDFVEKVIDSMDL
Ga0157601_110543913300012714FreshwaterMALSIDQIDDFVNSIHQKFAGEDRLAAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDQERDLMTSFYTGMEDLVFGPGPSSPTQTPNIVSSLLWWITSTSDSVTENNATEGFNGAEPVGWSS
Ga0157613_114694213300012720FreshwaterAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDQERDLMTSFYTGMEDLVFGPGPSSPTQSPNIVSSLLWWITSTSDSVTENNATEGFNGAEPVGWSSVGVGGISCTQYPQWRNRT
Ga0157611_124532113300012724FreshwaterIHQKFAGEDRLAAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDQERDLMTSFYTGMEDLVFGPGPSSPTQTPNIVSSLLWWITSTSDSVTENNATEGFNGAEPVGWSSVGVGGISCTQYPQWRNRTF
Ga0154020_1127340513300012956Active SludgeMALGIEQIDDFVNSIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLSEGEMKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESMERDLMTSFYTGMEDLIFGPGPSSPTQSPFPPVSLLWWLTATNDSTTENNSAEGFDGYAP
Ga0164313_1157609513300013101Marine SedimentLMPGIDQIDDFVASIHQRFAGEDRLAAQDISLSLQKYKYASRLFEGNLKKETMSTSQCKWKVKVDTNDNFQVVDLFHRDSSTRVNVLDEGELKWGLTTNNYHYDIDEEIFKTRGRAIYDYLKSLEDDMLTSFYTGMEGLIFGPGPSSPTQRPFPPVSLLWWITATDDSSSENNSE
Ga0171656_105239243300013118MarineMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHKDTTGRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLESDLMTSFYTGMEDVIFGAGPAASTTSPFPPVSLLWWITATDDSTSENNSEEGFDGFEPVGWSSAGVGGISCTTYKQWRNRTFPYTNVERDDFVEKTINSMDLCQFQPPVQRPDIVDQTRHDWELLTTHSRVAAGRRLLQLGNDN
(restricted) Ga0172369_1013855423300013125FreshwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESMEQDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGLNGVGGLSCATYSQWRNRTFPYTTVDRADFVEKIINSMDLCQFMPPVQRPDIVDQKRSDWELLTTHSRLAQARQLLQLGNDNIGDDMAAHSGTVYIRGTPLNWIPAW
(restricted) Ga0172366_1012455113300013128SedimentMALGIEQIDDFVAGIHQKFAGEERLAAQDLSLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLENDLMTSFYTGMEDLMFGPGPSTPTQSPFPPVSLLWWITATDDSTTENNSE*
(restricted) Ga0172370_1042580913300013136FreshwaterGIHQKFAGEERLAAQDLSLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESMEQDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGLNGVGGLSCATYSQWRNRTFPYTTVDRADFVEKIINSMDLCQFMPPVQRPDIVDQKRSDWELLTTH
(restricted) Ga0172375_1015689613300013137FreshwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESMEQDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGLNGVGGLSCATYSQWRNRTFPYTTVDRADFVEKIINSMDLCQFMPPVQRPDIVDQKRSDWELLTTH
(restricted) Ga0172371_1003913173300013138FreshwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDLSLPLQHYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLENDLMTSFYTGMEDLMFGAGPSTPTQ
Ga0170573_1090006213300013232SedimentMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDASTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLERDLVTSFYTGMEDLMFGPGPTSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGEGWATQAGSSVARQRLDASAQTLAAWCSDARPGHG
Ga0119868_116271623300014059Activated SludgeMALGIEQIDDFVNSIHQKFAGEEGLKAQDISLPLQEYKYASRLFDKNLSKDTMSTSQCKWKLKVRHNDNFQVVGLYHRDSSNRVNVLTEGSAKWSLTTNNYHYDIDEEIFRTGGKQIYDYIEDMERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTSEN
Ga0172380_1029489113300014205Landfill LeachateMALGIEQIDDFVNSIHQKFAGEERLAAQDISLPLQSYKYASRLFDSNLKKDTMSTSQCKFKIKVRTNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYMESLERDLMTSFYTGMEDLMFGPGPSSPVQSPFPPVSLLWWITSTDDSTTENNSEEGFDGFEPVGWGANGVGG
Ga0172380_1034654013300014205Landfill LeachateMALGIEQIDDFVASYLQRYPMGKWQDISSPLQEYYFASRLFNKAMKREMSTSQCKWKIKVRNNDNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTTNYHYDIDEEIFKQGASEIVNYMNLQEQGLMQDFFSGMEDLMFGAGPTSPTQSPFPPVSLLWWITSTDDSTTENNSEEGFDGYAPLGWSANGVGGISPVTYDQW
Ga0172380_1103828413300014205Landfill LeachateMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKMATNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLEQDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSL
Ga0172377_1016426433300014206Landfill LeachateMALGIEQIDDFVAGIHQKFAGEDRLAAQDLSLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLTEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLENDLITSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTT
Ga0180008_114184323300014613GroundwaterMALGIEQLDDFVASYLQKYPMGKWQNISPPLQKYYFASRLFDAANKREMSSSQCKWKLQVDNNNNFQVVGLYHRDSSSRVNVLTEGSLKWGMTTTNYHYDIDEEVFSKGADEIVNYMNLQEQGLMQDFFVGMEDLMFGPGPSSSTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPLGWGSAGVGGISCTTYSQWRNRTFPYTTVDRDDFIEKTINSMDLCSFTPPVERSDIKPEGK
Ga0180008_123430413300014613GroundwaterRAAQDISLPLQNYKYASRLFDPGGKNVMSTSQCKWKLKVRTNDNFQVVGLYHRDSSTRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYIADMERDLMTSFYTGMEDLMMGPGPSVPTQSPFPPTSLLWWITATDDSTSENNSEEGFDGYEPVGWGSNGVGGISCTTYEHWRNRTFPYTVVDRDDFVEKTINSMDLCEFEPPVQRPDIVPQGKPNWELLTTHSRLAA
Ga0180008_124180813300014613GroundwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYIESLESDLLTSFYTGMEDLMFGAGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGSNGVGGISCATYPQWRNRTFPYTTVDRADFVEKTIN
Ga0180008_133348123300014613GroundwaterMALGIEQIDDFVASIHQRYEGEDRRAAQDISLPLQKYKYASRLFDPAGNNVMSTSQCKWKVKVRTNDNFQVVGLYHRDSSGRVNVLDEGGLKWGLTTNNYHYDIDEEIFRTGGRQIYDYIADMERDLMTSFYTGMEDLIMGPGPSSPT
Ga0180008_138396413300014613GroundwaterVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVSLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLESDLLTSFYTGMEDLMFGAGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWG
Ga0180008_140084713300014613GroundwaterLFDSANKREMSTSQCKWKLKVDNNDNFQVVGLYHRDSSSRVNVLQEGSLKWGMTTTNYHYDIDEETFAQGAQAIVKYMDLQEQGLMQDFFVGIEDVMMGPGPASATQSPFPPVSLLWWITATDDSTTENNSEVGFDGYEPLGWGSVGVGGISCTDYDQWRNRTFPYAVVDRD
Ga0180007_1066210113300014656GroundwaterMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSSRVNVLSEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIGSMEADLLTSFYTGMEDLIFGPGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWVS
Ga0180007_1077084113300014656GroundwaterISLPLQKYYFASRLFDAANKREMSSSQCKWKLKIDNNSNFQVVGLYHRDSSSRVNVLAEGSLKWGMSTTNYHYDIDEEVFGKGADAIVNYLNLQEQGLMQDFFVGMENLMFGPGPSSSTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGSAGVGGISCTTYEQWRNRTFPYTTVDRDDFI
Ga0119960_102480313300014811AquaticFPVTIKEGNCTVALGIEQIDDFVNSIHQKFAGEEHLAAQDISLPLQEYKYASRLFSGNIKKDTMSTSQAKWKVKVNTNDNFQVVGLYHRDSSSRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGKQIYDYIESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYAPVGWGSNGVGGIDPTVYDQWRNRTFPYTNVDRDDFVEKIINSMDLCQFTPPVQRPDIVDQKRHDWELLTTPIRS*
Ga0181375_104376423300017718MarineMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTATNDNFQVVGLYHRDSSSRVNVLNEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPGSSTVSPFPP
Ga0180434_1017008613300017991Hypersaline Lake SedimentMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSTTRVNTLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYIEGLEQDLMTSFYTGMEDLMFGPGPTSPTQSPFPPVSLLWWITATDDSTTENNSEEGFD
Ga0180433_1070715023300018080Hypersaline Lake SedimentMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSTTRVNTLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYIEGLEQDLMTSFYTGMEDLMFGPGPTSPT
Ga0163151_1050704413300020057Freshwater Microbial MatIMALGIEQIDDFVNSILQEFAGEDRMAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSSRVNVLSEGSMKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWLTATDDSVSENNSEEGFDGYAPVGWGSNGVG
Ga0194112_1029391523300020109Freshwater LakeMALGIEQIDDFVASIHQRYEGEDRRAAQDISLPLQHYKYASRLFDPAGNNVMSTSQCKWKIKVRTNDNFQVVGLYHRDSSNRVNVLDEGELKWGLTVNNYHYDIDEEIFRTGGRQIYDYIADMERDLMTSFYTGMEDLIMGPGPSGPTVSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGANGVGGISCTTYDQWRNRTFPYTVVDREDFVERVINSMDLCQFEPPVQRPDIVAQGKPNWELLTTHSRLAAGRRLLQLGNDNIGDDMAAHSGSVYIRGVPMNWV
Ga0163146_1016946023300020219Freshwater Microbial MatMALGIEQIDDFVNSILQEFAGEDRMAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSSRVNVLSEGSMKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWLTATDDSVSENNSEEGFDGYAPVGWGSNGVGAIDPIAYDQWRNRTFPYTSVNREDFVEKVINSMDLCQFTPPV
Ga0194127_1060837613300020221Freshwater LakePMGKWQDISLPLQKYMFAARLFDAANKREMSTSQCKWKLKVDNNNNFQVVGLYHRDSSSRVNVLTEGSLKWGMTTTNYHYDIDEETFAQGASAIVNYLNLQEEGLMQDFFVGIEDLMFGPGPSSSTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGAVGSGGISCTTYPQWRNRTFPYTTVDRDDFVEKTINSMDMCTFEPPVARSDIKPEGKHRWELLTTHS
Ga0194127_1095406913300020221Freshwater LakeDRANKREMSTSQCKWKLKVDNNSNFQVVGLYHRDSSSRVNVLTEGSMKWGMTTTNYHYDIDEETFAQGADAIVDFMNLQEHGLMQDFFEGVEDLMFGAGPTSPTQSPFPPVSLLHWITATDDSTTENNSEEGFDGYEPLGFGSVGVGGISCTTYPQWRNRTFPYTTVDRDDF
Ga0224507_1028553113300022307SedimentIEQIDDFVASIHEKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSLAKWKVKVNTNDNFQVVGLYHRDTSSRVNVLSEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYLESLEQDLVTSFYTGMEDLIFGPGPSSPTQSPFPPVSLLWWITATDDSLTENNSEEGFDGYEPVGWASNGVGGISAVTYAQWRNRTFPYTVVDREDFVEKTINSM
Ga0224508_1040606513300022413SedimentMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSSRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLEQDLMTSFYTGMEDIIFGPGPSSSTTSPFPPVSLLWWITATDDSVTENNSEEGFDGYEPVGWTDVGGIDPSTYAQWRNRTFPYTVVDREDFVEKTINSMDLCQFEPPVQRPDIVDQKRSDWELLTTHSRLAAARRLLQLGNDNIGDDMAAHSGQVYI
Ga0208156_1000419263300025082MarineMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTATNDNFQVVGLYHRDSSSRVNVLNEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPGSSTVSPFPPVSLLWWITSTDDSVTENNSEEGFDGYEPVGWTDVGGIDPSTFDQWRNRTFPYTVVDREDFVEKTINSMDLCQFMPPVQRPDIV
Ga0209756_101495973300025141MarineMALGIEQIDDFVASYLQKYPMGKWQDISSPLQEYYFASRLFDKGTKREMSTSQCKWKVKVDNNDNFQVVGLYHRDSSDRVNVLTEGSLKWGLTTTNYHYDIDEEIFKQGADQIVDYMNLQEQGLMQDFFEGMENLMFGAGPTSPTQSPFPPCSLLWWITSTSDSTTENNAT
Ga0208019_117698213300025687AqueousWPSPKKNSDCIRRGVSHGMTCDPWYPDDELDDPLGDDFVASIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNTLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYIESMEHDLLTSFYAGMEDLMFGPGPSSPTQSPFPPVSLLWWITAT
Ga0209063_121612913300027705Activated SludgeMLAAQDISLPLQEYKYASRLFSGNLKKDTMATSQCKWKVKVNTNDNFAPVGLYHRDSSTRVSTLSEGELKWALTTNNYHYDIDEEIFQTGGRQIYDYIESMERDLMTSFYAGMEDLMFGPGPTGPTQTPFTVASLLWWITATDDSITENNSEEGFDGYAPVGWGASGVGGIDPTVYDQWRNRTFPYTNVDR
Ga0209174_1027020223300027789Wastewater EffluentMALGIEQIDDFVNSIHQKFAGEDMLAAQDISLPLQEYKYASRLFSGNLKKDTMATSQCKWKVKVNTNDNFQVVGLYHRDSSSRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQTPFPPVSLLWWITATDDSTTENNSEEGFDGYA
Ga0209742_1030115113300027814Marine SedimentFVASYLQKYPMGKWQDISLPLQEYMFASRLFDRANKREMSTSQCKWKLKIDNNDNFQVVGLYHRDTSSRVNVLTEGSLKWGMTTTNYHYDIDEETFAQGADAIVDYLNLQEQSLMQDFFVGVEDLMFGPGPASSTQSPFPPVSLLWWITSTSDSVTENNATEGFTGDAPVGWADV
(restricted) Ga0255055_1067504813300027881SeawaterQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDTTSRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLESDLMTSFYTGMEDVIFGPGPAASTTSPFPPVSLLWWITATDDSASENNSEEGFDGYEPVGWGSAGVGGISCTDYEHWRNRTFPYT
Ga0209536_10071540713300027917Marine SedimentMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFTGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSGRVNVLSEGSLPWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLESDLMTSFYTGMEDLMFGGGPSSPTQSPFPPVSLLWWITATDDSTSENNSEEGFDGYEPVGWGSNGVG
(restricted) Ga0233413_1024988723300027996SeawaterMALGIEQIDDFVNSIHQKFAGEDHLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNTLSEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIEGLEDDLMTSFYTGMEDLMFGPGPSSPTQSPFSPVSLLWWITATDDSTTEN
Ga0265309_1086747213300028599SedimentLPLQEYKYASRLFSGNLKKDTMSTSQAKWKVKVDTNDNFQVVGLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWANNGVGGISATTYPQWRNRTFPYTDVSREDFVEKTINSMDLCQFTPPVQR
Ga0272441_1079142013300028920Marine SedimentMALGIEQIDDFVASIHQKYEGEERLAAQDLSLPLQHYKYASRLFDPAGNNVMSTSQCKWKVKVRTNDNFQVVGLYHRDSSSRVNVLDEGSLKWGLTTNNYHYDIDEEIFRTGGRQIYDYIADMERDLMTSFYTGMEDLVMGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWGDNGVGGISCTTYDQWRNRTFPYTTVDRDDFIEKTINSMDLCQFEPP
Ga0168032_11868913300029183Aquarium WaterMALGIEQIDDFVASIHQKFAGEDRRAAQDISLPLQNYKYASRLFDNNLTKDTMSTSQCKWKLKVRTNDNFQVVGLYHRDSSNRVNVLDEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYLEDMERDLMTSFYTGMEDLIFGPGPSSPTATPFPPVIVTGK
Ga0265297_1025802013300029288Landfill LeachateMALGIEQIDDFVAGIHQKFAGEDRLAAQDLSLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLTEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLENDLITSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWIT
Ga0307420_127810413300031281Salt MarshRLFDSANKREMSTSQCKWKLKIDNNDNFQVVGLYHRDSSSRVNVLTEGSLKWGMTTTNYHYDIDEETFAQGADAIVNYLDLQEQGLMQDFFSGVEDLMFGAGPSSSTVSPFPPVSLLWWITSTSDSVTENNATEGFTGDAPVGWADVGGINPATYAQWMNRSFPYTT
Ga0307380_1030612913300031539SoilMALGIEQIDDFVAGIHQKFTGEDRLAAQDLSLPLQSYKYASRLFSGNLQKDTMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYMESLERDLMTSFYTGMEDIMFGPGPSSPTQSPFPPVSLLWWITSTDDSASENNSEEGFDGFEPVGWGSNGVGGISCTTYDQWRNRTFPYTVVDREDF
Ga0307380_1035961513300031539SoilMALGIEQIDDFVAGIHQKYIGEEKRAAQDISLPLQNYKYASRLFDPAGKNVMSTSQCKWKIKIDTNDNFAVVGLYHRDSSTRVNVLSEGEIKWGLTTNNYHYDIDEEIFRTGGRQIYDYIASLERDLMTSFYTGMEDLLMGAGPTSPTQ
Ga0307380_1051804313300031539SoilMALGIEQIDDFVNSIHQKFAGEEMLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQAKWKVKVNTNDNFQVVGLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGW
Ga0307380_1068267113300031539SoilMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQQYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDASTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLERDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSVTENNSEEGFDGYEPVGWTSNGVGGLSCSTYAQWRNRTFPYTTVDRADFVEKTINSMDLCQFQPPVQ
Ga0307380_1144812213300031539SoilEYMFASRLFDKANKREMSTSQCKWKLKIDNNDNFQVVGLYHRDVSDRVNVLTEGSLKWGMTTTNYHYDLDEETFAQGADAIVDYLNLQEQGMMQDFFAGVEDLMFGAGPNSSTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPLGWGSAGVGGISCSTYEQWRNRTF
Ga0307379_1008110313300031565SoilMALGIEQIDDFVAGIHQKFTGEDRLAAQDLSLPLQSYKYASRLFSGNLQKDTMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYMESLERDLMTSFYTGMEDIMFGPGPSSPTQSPFPPVSLLWWITSTDDSASENNSEEGFDGFEPVGWGSNGVGGISCTTYDQWRNRTFPYTVVDREDFVEKTINSMDL
Ga0307379_1014738443300031565SoilMALGIEQIDDFVNSIHEKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSDRVNTLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLEGMEQDLMTSFYKGMEDLMFGPGPSSPTQTPFSPVSLLWWITSTSDSTTENNATEGFTGAEPLGWGNNGVGGISTTDYPNWKNRAFPYEIVSRD
Ga0307379_1034638013300031565SoilMALGIEQIDDFVASIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQAKWKVKTNTNDNFQVVGLYHRDSSTRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLEQDLMTSFYTGMEDLMFGAGPSSSTQSPFPPVSLLWWI
Ga0307379_1040657123300031565SoilMALGIEQIDDFVASIHQKFAGEDRMAAQDISLPLQEYKYASRLFDGNLKKDTMSTSQCKWKLKVRTNDNFQVVGLYHRDSSNRVNVLDEGGLKWGLTTNNYHYDIDEEIFRTGGRQIYDYLEDMERDLMTSFYTGMEDIVFGPGPSSPTQSPFPPVSLLWWITSTDDSTSENNSEEGFDGFEPVGWGSNGVGDISCTTYDQWRNRTFPY
Ga0307379_1048380223300031565SoilMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTNTNDNFQVVGLYHRDSSSRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSSTQSPFPPVSLLWWITSTDDSITENNSEEGFDGYEPVGWTDVGGIDPGVYDQWRNRTFPYTTVDRDDFIEKTINSMDLCQFMPPVQRPDIVSQKRHDWELLTTHSRLAAGRRLL
Ga0307379_1052397723300031565SoilMALGIEQIDDFVADIHQKYIGEEKRAAQDISLPLQNYKYASRLFDPAGKNVMSTSQCKWKIKIDTNDNFAVVGLYHRDSSTRVNVLSEGEIKWGLTTNNYHYDIDEEIFRTGGRQIYDYIASLERDLMTSFYTGMEDLLMGAGPTSPTQSPFPPTSL
Ga0307379_1070883613300031565SoilMALGIEQIDDFVASIHQKFAGEDRLAAQDISLPLQEYKYASRIFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDASTRVNVLAEGELKWGLTTNNYHYDIDEEIFKTGGREIYDYIESLEQDLVTSFYTGMEDLMFGPGPTSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWTSNGVGGLSCSTYAQWRNRTFPYTTVDRADFVEKTINSMDLCQFQPPVQRPDIVDQKRHDWELLTTHSRIAQARQLLQLGNDNIG
Ga0307379_1071835923300031565SoilMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNTLSEGELKWGLTTNNYHYDIDEEIFRTDGRQIYDYIEGMEQDLLTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWGSNGVGGISCSTYAQWRNRTFPYTTVDRADFVEKTINSMD
Ga0307379_1133466413300031565SoilGNLKKDTMSTSQCKWKVKVNTNDNFQPVGLYHRDSSTRVNVLSEGSLKWALTTNNYHYDIDEEIFQTGGRQIYDYIESLERDLMTSFYTGMEDLMFGPGPTSPTESPFTVASLLWWITATDDSVTENNSEEGFDGYAPVGWGSNGVGGIDPTVYDQWRNRTFPYTNVDREDFVEKVITSMDLCQFTPPVQRPDI
Ga0307379_1149342313300031565SoilAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTNTNDNFQVVGLYHRDSSSRVNVLTEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDIMFGPGPTSPTASPFPPVSLLWWITATDDSVTENNSEEGFDGYAPLGWTSNGVGGIDPIVYDQWRNR
Ga0307378_1009543763300031566SoilMALGIEQIDDFVASIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQAKWKVKVDTNDNFQVVGLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYIESLERDLMTSFYTGMEDLMFGAGPTSPTQSPFPPVSLLWWITATDDSITENNSEEGFDGYAPLGW
Ga0307378_1032405623300031566SoilMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNTLSEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIEGMEQDLLTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWGSNGVGGISCSTYAQWRNRTFPYTNVERADFVEKIINSMDLCSFTPPVQRPDIVDQKRHDWELLTTHSRIAKSRQLLQLGNDNIGDDMAAHSGTVYIRG
Ga0307378_1034970913300031566SoilMALGIEQIDDFVAGIHQKFTGEDRLAAQDLSLPLQSYKYASRLFSGNLQKDTMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDIMFGPGPSSPTQSPFPPVSLLWWITSTDDSASENNSEEGFDGFEPVGWGSNGVGGI
Ga0307378_1049894323300031566SoilMALGVEQIDDFVNSIHQKFAGEDKLAAQDLSLPLQSYKYASRLFDGKLAKETMSTSQCKWKLKVRTNDNFQVVGLYHRDSSNRVNVLDEGEMKWGLTTNNYHYDIDEEIFRTGGKQIYDYLADLERDLMTSFYTGMEDLMFGPGPSASTQSPFPPVSLLWWITSTDDSTSENNSEEGFDGFEPVGWGSSGVGGISCTTYDQWRNRTFPYATVDRDDFVEKTINSMDLCQFEPPVERPDIVTQARPNWELLTTHSRLAAARRLAQLGNDNIGDDLAAHSGSVRIRGVPLNWVP
Ga0307378_1071856823300031566SoilMALGIEQIDDFVNSIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSDRVNTLSEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLEGMEQDLMTSFYKGMEDLMFGPGPSSPTQTPFSPVSLLWWITSTSDSTTENNATEGFTGAEPLGWGNN
Ga0307378_1072225613300031566SoilMALGIEQIDDFVASYLQKYPMGKWQDISSPLNEYYFASRLFDKGMKREMSTSQAKWKIKVRNNNNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTTNYHYDIDEEVFKTGADQIVDYMNLQEQGLMQDFFEGMEDLMFGPGPTSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPLGWGSNGVGGISAVTYDQWRNRTFPYTVVDRDDFVEKVINSMDLCTFKPPVQRSDIKPEGNHRWELLTTHSRIATARRLLQLGNDNIRDDLAA
Ga0307376_1032424723300031578SoilMALGIEQIDDFVASYLQKYPMGKWQDISSPLNEYYFASRLFDKGMKREMSTSQAKWKIKVRNNNNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTTNYHYDIDEEVFKTGADQIVDYMNLQEQGLMQDFFEGMEDLMFGPGPTSPTQSPFPPVSLLWWI
Ga0307376_1054299023300031578SoilMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQSYKYASRLFSGNLKKDTMCTSQCKWKVKVDTNDNFQVVGLYHRDTSTRVNVLSEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLEQDLMTSFYTGMEDLMFGAGPSSSTQSPFPPVSLLWWITATNDGVTENNSAEGFDGYEPVGWTDIGGIDPATQAQWRNRTF
Ga0307377_1024656423300031673SoilMALGIEQIDDFVNSIHQKFAGEDKLAAQDLSLPLQSYKYASRLFDGKLAKETMSTSQCKWKLKVRTNDNFQVVGLYHRDSSNRVNVLDEGEMKWGLTTNNYHYDIDEEIFRTGGKQIYDYLADLERDLMTSFYTGMEDLMFGPGPSASTQSPFPPVSLLWWITSTDDSTSENNSEEGFDGFEPVGWGSSGVGGISCTTYDQWRNRTFPYATVDRDDFVEKTINSMDLCQFEPPVERPDIVTQARPNWELLTTHSRLAAARRLAQLGNDNIGDDLAAHSDSVRIRG
Ga0307377_1054952123300031673SoilMALGIEQIDDFVAGIHQKFTGEDRLAAQDLSLPLQSYKYASRLFSGNLQKDTMSTSQCKWKIKVRTNDNFQVVGLYHRDTSDRVNVLDEGSLKWGLTTNNYHYDIDEEIFQTGGRQIYDYMESLERDLMTSFYTGMEDIMFGPGPSSPTQSPFPPVSLLWWITSTDDS
Ga0315288_1143430313300031772SedimentEYMFASRLFDSANKKEMSTSQCKWKLKVDNNDNFQVVGLYHRDSSSRVNVLTEGSMKWGMTTTNYHYDIDEETFAQGADAIVDYMNLQEQELMQDFFAGIEDLMFGAGPASPTQSPFPPVSLLHWITSTDDSTTENNSEEGFDGYEPLGFGSVGVGGISCTTYEQWRNRTFPYVTVDRDDFVEKVINSMDM
Ga0315899_1175167713300031784FreshwaterMALSIDQIDDFVNSIHQKFAGEDRLAAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGKQIYDYIEDMERDLMTSFYTGMEDLVFGPGPTAPTQTPFSVASLLW
Ga0315908_1007095713300031786FreshwaterMALSIEQIDDFVNSIHQKFAGEERLAAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDQERDLMTSFYTGMEDLVFGPGPSSPTQTPNIVSSLLWWITSTSDSVTENNATEGFNGAEPVGWSSVGVGGISCTQ
Ga0310120_1002205143300031803MarineMALGIEQIDDFVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVDTNDNFAVVGLYHRDSSTRVNVLAEGELKWGLTSNNYHYDIDEEIFRTGGRQIYDYLESLEQDLVTSFYTGMEDLMFGAGPTSSTQSPFPPVSLLWWITSTDDSITENNSEEGFDGYEPVGWTDVGGIDPSTYAQWRNRTFPY
Ga0310124_1061065613300031804MarineMALGIEQIDDFVASTLQKFPMGKWQDISSPLQEYYFASRLFDKGTKREMATSQCKWKIKVRNNANFQVVGLYHRDSSDRVSVLDEGSLKWGLTTTNYHYDIDEEIFKQGPLEIVDYLQLQEQGLMQDFFEGMEDIMFGAGPTSPTQSPFPPTSLLWWITA
Ga0315909_1007024913300031857FreshwaterMALSIEQIDDFVNSIHQKFAGEERLAAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDQERDLMTSFYTGMEDLVFGPGPSSPTQSPNIVSSLLWWITSTSDSVTENNATEGFNGAEPVGWSSVGVGGIS
Ga0315901_1048895623300031963FreshwaterMALSIEQIDDFVNSIHQKFAGEEMLAAQDLSLSLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQTVGLYHRDSSTRVNTLDEGELKWALTTNNYHYDIDEEIFRTGGKQIYDYIEDMERDLMTSFYTGMEDLVFGPGPTAPTQTPFSVASLL
Ga0315906_1002788873300032050FreshwaterMALSIEQIDDFVNSIQQKFAGEESLAAQDLSLPLQSYKYASRLFSGNLKKDTMSTSQCKWKIKVNTNDNFQTVGLYHRDSSTRVNTLDEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEGLEQDLMTSFYTGMEDLIFGPGPTGPTQSPFSVASLLWWITSTNDSVNENN
Ga0315906_1045119023300032050FreshwaterMALSIEQIDDFVNSIHQKFAGEERLAAQDLSLTLQKYHYASRLFSGNLKKDTMSTSECRWKVKVGYQDNFQSVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDQERDLMTSFYTGMEDLVFGPGPSSPTQTPNIVSSLLWWITSTSDSVTENNATEGFNGAEPVGWSSV
Ga0315905_1095608323300032092FreshwaterMALSIEQIDDFVNSIQQKFAGEESLAAQDLSLPLQSYKYASRLFSGNLKKDTMSTSQCKWKIKVNTNDNFQTVGLYHRDSSTRVNTLDEGSLKWALTTNNYHYDIDEEIFRTGGRQIYDYIEGLEQDLMTSFYTGMEDLIFGPGPTGPT
Ga0310342_10003698913300032820SeawaterMALGIEQIDDFVASYLQKFPMGKWQDISSPLNEYYFASRLFDKMNKREMSTSQCKWKIKVRNNSNFQVVGLYHRDSSDRVNVLDEGSLKWGLTTTNYHYDIDEEIFKQGADEIVDYMNLQEQGLMQDFFEGMEDIMFGPGPSSPTQSPFPPTSLLWWITATDDSTSENNSEEGFDGFEPLGWGSNGVGGISCTTYDQWRNRTFPYTVVDRDDFVEKVINSMDLCTFKPPVSRSDIKPEGNHRWELL
Ga0214472_1061727413300033407SoilMGLGIEQIDDFVASIHQKFAGEEHLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQVVGLYHRDSSTRVNVLSEGALKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLERDLMTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYAPVGWGANGVGGIDPTVYDQWRNRTFPYTNVDREDFVEKVINSMDLCQFTPPVQRPDIVDQKRHDWELLTTHSRLAAARRLLQLGNDNIGDDMAAHSGTVYIRGVPLTWVPA
Ga0214472_1177235913300033407SoilVAGIHQKFAGEDRLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQAKWKVKVDTNDNFQVVGLYHRDSSTRVNVLSEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYLESLEQDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPV
Ga0316626_1062976113300033485SoilMALGIEQIDDFVAGIHQKFAGEERLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKIDTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLEQDLVTSFYTGMEDLMFGPGPSSSTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWGSVGVGGLSCTTYA
Ga0316626_1199176613300033485SoilYMFASRLFDRANKAEMSTSQCKWKLKVDNNNNFQVVGLYHRDSSSRVNVLTEGSMKWGMTTTNYHYDIDEETFAQGADAIVDYMNLQEQGLMQDFFAGIEDLMFGPGPSSPTQSPFPPVSLLHWITSTDDSTTENNSEEGFDGYEPLGFGSVGVGGISCTTYEQWRNRTFPYVAV
Ga0316616_10355866513300033521SoilSRLFSGNLKKDTMSTSQCKWKVKVDTNDNFQVVGLYHRDSSTRVNVLAEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYIESLEKDLVTSFYTGMEDLMFGPGPSSPTQSPFPPVSLLWWITATDDSTTENNSEEGFDGYEPVGWGSNGVGGLSCTTYSQWRNRTFPYTTVDRADFVEKVINSMDLCQFMPPVQ
Ga0335000_0392717_232_8253300034063FreshwaterMALSIEQIDDFVNSIHQKFAGEEQLAAQDLSLPLQEYKYASRLFSGNLKKDTMSTSECRWKVKVNTNDNFQTVGLYHRDSSTRVNTLDQGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDMERDLMTSFYTGMEDLVFGPGPVGPTQSPFSVASLLWWITATNDSVTENNAPEGFNGFEPVGWGANGVGGISCAQ
Ga0335031_0351108_464_9403300034104FreshwaterMALSIEQIDDFVNSIHQKFAGEEMLAAQDLSLSLQEYKYASRLFSGNLKKDTMSTSQCKWKVKVNTNDNFQTVGLYHRDSSTRVNTLDEGELKWALTTNNYHYDIDEEIFRTGGRQIYDYIEDMERDLMTSFYTGMEDLVFGPGPTAPTQTPFSVASLL
Ga0326748_013013_3_4673300034656Filtered SeawaterMALGIEQIDDFVAGIHQKFIGEDKLAAQDISLPLQEYKYASRLFSGNLKKDTMSTSQCKWKVKTATNDNFQVVGLYHRDSSSRVNVLNEGELKWGLTTNNYHYDIDEEIFQTGGRQIYDYLESLESDLMTSFYTGMEDLMFGPGPASSTVSPFPP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.