NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168029_104610

Scaffold Ga0168029_104610


Overview

Basic Information
Taxon OID3300029174 Open in IMG/M
Scaffold IDGa0168029_104610 Open in IMG/M
Source Dataset NameAquariaum water viral communities from Chicago, USA - Amazon Rising - AZ1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMichigan State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1062
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa

Source Dataset Sampling Location
Location NameUSA: Chicago
CoordinatesLat. (o)41.87Long. (o)-87.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053563Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0168029_1046101F053563N/AFPSHDQKRLSTEGQNVVDNRFWGSDPSILNKQIKKAKEISGQVEDPKTGEILEEGAPVYGVYFNAAGDNVNFSTMVSDVTLNMLPNMKITKKAAKQFDEKLRERIPDWPGLNNLEASDIDAVRTYFRGPNRGEARKAFSEEMAKPRSMKLGFPDQASVRAAVSKADMLGMGSGDAAGRMIAQIDYNAPVDPVSMHTTYPAGLKRVEGTPVYRMADESGNFRDVPTSMFFNDFYNDRIIDGVVPPEATTIRSMELRQATQPATRELSDIINEYLYQTDDTRRGYPYNR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.