Basic Information | |
---|---|
Taxon OID | 3300029174 Open in IMG/M |
Scaffold ID | Ga0168029_104065 Open in IMG/M |
Source Dataset Name | Aquariaum water viral communities from Chicago, USA - Amazon Rising - AZ1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Michigan State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1144 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Chicago | |||||||
Coordinates | Lat. (o) | 41.87 | Long. (o) | -87.61 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086975 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0168029_1040653 | F086975 | N/A | MLSPRLTSCPECASIPALIADIDCKLASLANNLYNNVVFMLNQPVPGGVMLALINYRRILAYKYCNPDYAAPFTVNMIAS |
⦗Top⦘ |