Scaffold Ga0168029_100009

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168029_100009

Scaffold Ga0168029_100009

Overview

Basic Information
Taxon OID	3300029174 Open in IMG/M
Scaffold ID	Ga0168029_100009 Open in IMG/M
Source Dataset Name	Aquariaum water viral communities from Chicago, USA - Amazon Rising - AZ1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Michigan State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	34952
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (37.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa

Source Dataset Sampling Location
Location Name	USA: Chicago
Coordinates	Lat. (^o)	41.87	Long. (^o)	-87.61	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086799	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168029_10000923	F086799	N/A	MKVTKVAYSRLVSKGNYENAKIEIEAEVEQGDLARDVYEKIKEWVDKRVEIEKMSDAAIMRARRVMEDKRHHTLAQIEEAEELLKKCGPDDSLPF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.