NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168978_100744

Scaffold Ga0168978_100744


Overview

Basic Information
Taxon OID3300029109 Open in IMG/M
Scaffold IDGa0168978_100744 Open in IMG/M
Source Dataset NameHuman oral microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002637-96
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16340
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location NameChina: Beijing, Peking Union Medical College
CoordinatesLat. (o)39.911947Long. (o)116.4156125Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095630Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0168978_10074416F095630N/AMRYSPLYKTSKDNGLIAHVYEHLLAQYVLKYLQDKGFFISSDIILTAKTYGDTCYMDVELYNPAAPNAYNEALQVFDKHTIPEKAVRRAVSECGIEMNRAVLELKQDELMSNLSRMQSSDWRQQSEMTYRKSYDKSSVDTLFCVPYLKYGKKSKKLFPEYVLEYSIDEEYINSPIDQALAAIVMQAVALNFLVAVRENYTVYDRGDQWSEASLSVGYRMFLGLAKEDKQITSQLKHEFTAYIQYLLKSPFCSNLQKALLRCSCNLEQVLLGRSTLNNILGGCVIGGRGWLEMADDARIKQMIAAIQLDVYDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.