Scaffold Ga0169175_100221

Overview

Basic Information

• Taxon OID: 3300029102
• Scaffold ID: Ga0169175_100221
• Source Dataset Name: Human fecal microbial communities from mother in Denmark - 103_M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 55844
• Total Scaffold Genes: 102
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 96 (94.12%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 55.676097
  • Long. (^o): 12.568337

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067720	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169175_10022174	F067720	AGGAG	MASTTYRHLGDVTGMYAAQEQFREVTKMVTKRYRFAVIVNMVRNAGQLPQPFWLGAACGGGSCSLSASVARA