Scaffold Ga0169212_101841

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169212_101841

Scaffold Ga0169212_101841

Overview

Basic Information
Taxon OID	3300029101 Open in IMG/M
Scaffold ID	Ga0169212_101841 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from mother in Denmark - 157_M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13060
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (76.19%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location
Location Name	Denmark
Coordinates	Lat. (^o)	55.676097	Long. (^o)	12.568337	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087335	Metagenome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169212_1018416	F087335	AGGAGG	MLELYFNDGNFLPESREEEQSAETVLNIMLAGKTTDTEMCIWPCFYHAPMCKGVLINLDDGTTLRIKPTLNEVGEPELLIGCVTDETVGEVYQRVSNYDFDEPCAGSMPS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.