Basic Information | |
---|---|
Taxon OID | 3300029087 Open in IMG/M |
Scaffold ID | Ga0169172_100103 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from infant at 12 months in Denmark - 103_12M |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 78602 |
Total Scaffold Genes | 91 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 77 (84.62%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Denmark | |||||||
Coordinates | Lat. (o) | 55.676097 | Long. (o) | 12.568337 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029444 | Metagenome | 188 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0169172_10010375 | F029444 | N/A | MEVSGQLTGFEREDLMSWTVSNLQRPLREDVSLEISGIIAEKESQIFGRRFVGFGGPKKAAPFFNF |
⦗Top⦘ |