Scaffold Ga0169717_127188

Overview

Basic Information

• Taxon OID: 3300029033
• Scaffold ID: Ga0169717_127188
• Source Dataset Name: Human fecal microbial communities from mother in Denmark - 504_M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1070
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032286	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169717_1271881	F032286	N/A	RCRTLVFDARLFVGNAADDTLVTGGTFRFCRLMCLCVKRRNVKPDSKHRSLPDSALFHADNRTEQKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDRKRAEI