Scaffold Ga0310375_1022294

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310375_1022294

Scaffold Ga0310375_1022294

Overview

Basic Information
Taxon OID	3300028923 Open in IMG/M
Scaffold ID	Ga0310375_1022294 Open in IMG/M
Source Dataset Name	Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG0 msp
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1011
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture

Source Dataset Sampling Location
Location Name	USA: Oklahoma
Coordinates	Lat. (^o)	36.0	Long. (^o)	-97.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073228	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310375_10222941	F073228	N/A	TIGDIMDVNNSKYGEFLYKIVMVYPHNLEVDQTELARLIKINNNTLTFERKTGEKFTLDERDIEHMDLFRSPNYKGGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.