| Basic Information | |
|---|---|
| Taxon OID | 3300028916 Open in IMG/M |
| Scaffold ID | Ga0310376_1002834 Open in IMG/M |
| Source Dataset Name | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto, Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 13074 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -97.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092111 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310376_10028342 | F092111 | GGAGG | VTPEEESSDVREMVWEMSRTTNKILIIGIVLVLAILAALIYLGIITFS |
| ⦗Top⦘ |