| Basic Information | |
|---|---|
| Taxon OID | 3300028908 Open in IMG/M |
| Scaffold ID | Ga0256914_1000062 Open in IMG/M |
| Source Dataset Name | Hydrothermal chimney microbial communities from Main Endeavour vent field at the Juan de Fuca Ridge, Pacific Ocean - Hulk |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 99765 |
| Total Scaffold Genes | 89 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 78 (87.64%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Chimney → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: Juan de Fuca Ridge | |||||||
| Coordinates | Lat. (o) | 47.5696 | Long. (o) | -129.5902 | Alt. (m) | Depth (m) | 2190 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052283 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256914_100006262 | F052283 | AGGAGG | MNPKQKSMLIGAIIGAALGAVGGYLFTRGLELPREEPARGFSFRKIPPGEMVALFISIMGVLRGLAELGERLEVN |
| ⦗Top⦘ |