3300028908: Hydrothermal chimney microbial communities from Main Endeavour vent field at the Juan de Fuca Ridge, Pacific Ocean - Hulk

Overview

Basic Information

• IMG/M Taxon OID: 3300028908
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046784 | Gp0296323 | Ga0256914
• Sample Name: Hydrothermal chimney microbial communities from Main Endeavour vent field at the Juan de Fuca Ridge, Pacific Ocean - Hulk
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 555852493
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Chimney → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Pacific Ocean: Juan de Fuca Ridge
• Coordinates
  • Lat. (^o): 47.5696
  • Long. (^o): -129.5902
  • Alt. (m): N/A
  • Depth (m): 2190

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052283	Metagenome / Metatranscriptome	143	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256914_1000062	All Organisms → cellular organisms → Bacteria	99765
Ga0256914_1033265	All Organisms → cellular organisms → Bacteria	2509

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256914_1000062	Ga0256914_100006262	F052283	MNPKQKSMLIGAIIGAALGAVGGYLFTRGLELPREEPARGFSFRKIPPGEMVALFISIMGVLRGLAELGERLEVN
Ga0256914_1033265	Ga0256914_10332653	F052283	MNPKQKSMLIGAVIGAALGAVGGYLFTRGLELPREDEPARGLSLRKVPPGEMVALFIAIMGVLRGLAELGERIEVN