Scaffold Ga0256407_10003188

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256407_10003188

Scaffold Ga0256407_10003188

Overview

Basic Information
Taxon OID	3300028886 Open in IMG/M
Scaffold ID	Ga0256407_10003188 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_04
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	29727
Total Scaffold Genes	39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	30 (76.92%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	Canada: Alberta
Coordinates	Lat. (^o)	49.6935	Long. (^o)	-112.8418	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072949	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256407_100031889	F072949	AGGAG	MAKRKGKVVNKVVVDKNAAQFMRTAQNLYKKGKTNKKLKGRNANPKAMKYNIA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.