NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307278_10008557

Scaffold Ga0307278_10008557


Overview

Basic Information
Taxon OID3300028878 Open in IMG/M
Scaffold IDGa0307278_10008557 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4831
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016026Metagenome / Metatranscriptome250Y
F024196Metagenome / Metatranscriptome207Y
F096826Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0307278_100085575F016026AGAAGGMARVEIGGRRQGQEVWARWIDGHVQGDREFLRVAGLDPGTRFEDPHAFVELIQGLLDDGTATVVLDVPPRPA
Ga0307278_100085576F096826N/AMGAVQRFTITIETPNWKDVQEVELPQLPGEGDAIETRYGTCIVTQAELSPESGQYAGKIVCRLP
Ga0307278_100085578F024196AGTAGGMRLKMSALLGAATLALMLAVPAFAFDCSVAKKPPTAGAVGIVDANDEFTPLKSNPGTEEQPHGGFVAFTDGEITVSTFLHAPDGVLPPVRSGGPQDNCDGKGLDSLEECFGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.