NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307333_102846

Scaffold Ga0307333_102846


Overview

Basic Information
Taxon OID3300028852 Open in IMG/M
Scaffold IDGa0307333_102846 Open in IMG/M
Source Dataset NameMetatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Asn2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2178
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094051Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0307333_1028463F094051GGAGGMGNTGILGKVQIEGNWTQKRLILPVIQAALERTSLASPAIGPTMTYAKLKGTIPLLGPVPVQSQLDEFEHAVGGGGKPSGFDIEVLKDRVVLYVSDEAEIESDVGNPMSLQQQAAAGALAANLNKLIAERLNTTPQVYGTGGDLGNWTSVKPTLAVGKMAAAMGVHRPTALVMGTLAGAYYVDAVGDKVAIANLAEWRGAVSIHPTLNIPVFISTDVDKLDDTSGNRYVFGVCNTTPGVVTVLSKIKARQYDDPKLGAQVYQYDIWRSPFSNIQQTSGNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.